PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 676754398
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Sisymbrieae; Sisymbrium
Family Whirly
Protein Properties Length: 273aa    MW: 30388.4 Da    PI: 9.8489
Description Whirly family protein
Gene Model
Gene Model ID Type Source Coding Sequence
676754398genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Whirly216.33e-67952341139
     Whirly   1 svyktkaalkvkavrptfealdsgnlklkraGglllelanataerkydWekkqsfalsatevaelvdlaskesceffhdpa.akgsneGkvrkalkvePl 99 
                s+yk+kaal++++++p+f+al+sg++kl ++G+lll++a+a+++r+ydW++kq+f+ls+te+++lv+l+++esceffhdp   kgs+eGkvrk+lkvePl
  676754398  95 SIYKGKAALTIEPRAPEFVALESGAFKLAKEGFLLLQFAPAAGVRQYDWSRKQVFSLSVTEIGNLVSLGPRESCEFFHDPYkGKGSDEGKVRKVLKVEPL 194
                7*******************************************************************************945679************** PP

     Whirly 100 pdGsGlfvnlsvtnslvkgnesfsvPvskaefavlrsllv 139
                pdGsG f+nlsv+n+l++++es+++Pv+kaefavl+s+++
  676754398 195 PDGSGRFFNLSVQNKLLNVDESVYIPVTKAEFAVLISAFN 234
                *************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.30.31.101.3E-7783256IPR009044ssDNA-binding transcriptional regulator
SuperFamilySSF544478.63E-8087273IPR009044ssDNA-binding transcriptional regulator
PfamPF085363.3E-5896231IPR013742Plant transcription factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006281Biological ProcessDNA repair
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0045910Biological Processnegative regulation of DNA recombination
GO:0009508Cellular Componentplastid chromosome
GO:0009570Cellular Componentchloroplast stroma
GO:0003677Molecular FunctionDNA binding
GO:0003723Molecular FunctionRNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MSQHYLQLLS SSPMALNSKL FVNHRFPDAS FLTAGGFSGK GYSFAVKPRE RVKLSVKSRQ  60
EDYFEKKRFG DSSSSSAYSP QNAEGSSPRF YVGHSIYKGK AALTIEPRAP EFVALESGAF  120
KLAKEGFLLL QFAPAAGVRQ YDWSRKQVFS LSVTEIGNLV SLGPRESCEF FHDPYKGKGS  180
DEGKVRKVLK VEPLPDGSGR FFNLSVQNKL LNVDESVYIP VTKAEFAVLI SAFNFILPHL  240
IGWQAFANSI KPEDSNRLNN ASPKYGGDYE WSR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4koq_A1e-115832512169Single-stranded DNA-binding protein WHY3, chl
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0153360.0BT015336.1 Arabidopsis thaliana At2g02740 gene, complete cds.
GenBankBT0156410.0BT015641.1 Arabidopsis thaliana At2g02740 gene, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006395762.11e-177hypothetical protein EUTSA_v10004763mg
SwissprotQ66GR61e-168WHY3_ARATH; Single-stranded DNA-binding protein WHY3, chloroplastic
TrEMBLV4L0251e-177V4L025_EUTSA; Uncharacterized protein
STRINGAT2G02740.11e-166(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM50232752
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02740.11e-167ssDNA-binding transcriptional regulator